SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM02G03280.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM02G03280.1
Domain Number 1 Region: 138-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  OGLUM02G03280.1
Domain Number - Region: 1026-1077
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000432
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM02G03280.1
Sequence length 1077
Comment pep:novel chromosome:ALNU02000000:2:2432627:2438791:-1 gene:OGLUM02G03280 transcript:OGLUM02G03280.1 description:""
Sequence
MASMKQQQTPASSAVTAAAAAASSSATAAVAACEGERKAAAINSELWHACAGPLVSLPPV
GSLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHGVNLHADPDTDEVYAQMT
LQPVNTYGKEALQLSELALKQARPQMEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDF
SMQPPAQELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIVVRDEK
HQLLLGIRRANRQPTNISSSVLSSDSMHIGVLAAAAHAAANSSPFTIFYNPRASPTEFVI
PFAKYQKALYSNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRNLQVG
WDESAAGERRNRVSIWEIEPVAAPFFLCPQPFFGVKRPRQLDDESEMENLFKRAMPWLGE
EVCIKDTQNQNSTAPGLSLVQWMNMNRQQSSSLANTAAQSEYLQALGNPAVQNLAADELA
RQLYVQNNLLQQNCIQFNSPKLPQQMQTMNDLSKAAIPLNQLGAIINPQDQKQDAVNHQR
QQNSIQVIPLSQAQSNLVQAQVIIQNQMQQQKPSPTQNPQRINGQRLLLSHQQQDQNLQL
QQQLLLQQKQQLQQQQQQQQNQQQLNKSLGQLVNLASQQSKLFDEELQLQILQKLQQQSL
MSQSTSTLSQPPLIQEQQKLITDMQKQLSNSHSLAQQQMMPQQEIKPSLQATPLLPTVQQ
EQQQKLLQKQVSLADVSGVAFQPISSTNVIPTTGGAMIISGATQSVVTEEMPSCSTSPST
ANGNHFTQSTKNRHCINTERLPPSTAPMLIPTSIDAVIATPLMTKELPKPNNNVKQSVVN
SKLPNVAPGPQNCINNALQTDNLETSSSATSLCPSRTDGLVHQGFPSSNFNQHQMFKDAL
PDVEMEGVDPSNSGLFGINNDNLLGFPIETEDLLINALDSVKYQNHISTDVENNYPMQKD
ALQEISTSMVSQSFGQSDMAFNSIDSTINDGAFLNKNSWPTAPLLQRMRTFTKVYKRGAV
GRSIDIGRYSGYEELKHALARMFGIEGQLEDRQRIGWKLVYKDHEDDILLLGDDPWE
Download sequence
Identical sequences A0A0D9YM67
OGLUM02G03280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]