SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM02G15230.5 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM02G15230.5
Domain Number 1 Region: 440-532
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000153
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM02G15230.5
Sequence length 543
Comment pep:novel chromosome:ALNU02000000:2:14193827:14199761:1 gene:OGLUM02G15230 transcript:OGLUM02G15230.5 description:""
Sequence
MAVVRAVCDLLISDEVGPPTTTPQAAQRANGPDPGIGSHAAAPADGHGEEEEEAPSPRPS
SAGCYTFLRSASRRGRHRRLDSSASASAAAHVVRVEVGTTKGERSLFPRRPDRARGRAGV
APPRGGRAADPRRRGGSRRGRFAVRAPVHTPTSSLPSPSWVINSPSSRPLAPPDSVDVIP
PLAIVGRRAATPQPLPSHAAGPCRKTSTGHNHRCPLLQQIHATGRRPQSQCDLEVEKLGV
GWVGLYEGFEGVCIADHGCGVVLPSWDAGSDRCSGRGDDCFFLGWEPPFADLAATDARIS
FPVCVPEDLWDASNSSNSDRAHLIPAMFSIMYGKVGISADTPSSTSDSFFSDSLNSSCGQ
SLIGMMFAQAWGNPVSSILLPDTSDTSSNTKTDLSSDTPSNTTMTGSTKRTFNELCFCAK
NVDPTADLKKYIEDLEECLDRSSKFYAVAVNNTFMKQDRVYCTKEFSQDYLKPLMEGKET
ISIGVQMAGGVSKNMILHMSTDGRCNLKKGWAKFATRNHIYLQSLCTFHFYKITRLEATF
DVL
Download sequence
Identical sequences A0A0D9YRP7
OGLUM02G15230.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]