SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM02G23240.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM02G23240.1
Domain Number 1 Region: 378-471
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-16
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 999-1070
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000275
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM02G23240.1
Sequence length 1071
Comment pep:novel chromosome:ALNU02000000:2:24242554:24248342:-1 gene:OGLUM02G23240 transcript:OGLUM02G23240.1 description:""
Sequence
MDGAVRGQGCVGRLRSFNKTKKKNRNCSDDMRNGDDEEKKKYSHHDMKKNLRNDANEEKR
KSSDDMRDGDFEEKKCSRHDMKKNLRNDANEERRKSSDDMRDGDDEEKKKCSRQDMKKNL
RNDADEEKRKSSDDMRDGDDEEKKKRSRHDMKKNSRNDADEEKRKRKRKCSDDLKKSVLN
DASKEATSHSDWRKNRKAGSDAEQRGKKLLNGDKKAKSRKVTTPFFEKMRKIKMQRTSNQ
NGEKNMKSDGDSYKKTVPLSVNKGKMEKDGTNKRTLSNTLVAKERKMRPSDSMEMKMKKK
KRDASFVQPDERTAQTFSTKNKEKKRKAPSTPLKREQKERVASSDNKKETKKACIVAIGN
EKKNCRDGKKKKRKAAFAFFKFVRDEFEELLFIPPAVAPSLKDLIDRHVYLEDSEGKCSK
IRLSVVDGSLAFYEGWNSFVSEHCIKWGEFLLFEYTPESTFSVRVFGIDSCERLHFSVKS
GGKGAVKKRKERHTLSDDLISHYNGQYQDSEDIHDGPNVSGESPRSKEPKITVDAEIGTR
NLVAKSINAASETQDSERVESGIGYGSLGALGNKVRNLSNGECDTRSDSVFCIQEKTRRS
EVIIISDEAYSTQVDEDTMKQTAPSEASEIHHVTINTQKDLERVVDGVCCESSVALNNKM
GNLILGEPKNKNISPACSTEKTNGSEITPTTGAIPLTQENIDTVKLNTISCFEEDRSTTR
ESELAAAIPTTSETHDSDKDLGQKHQRNSVQVNSIIAVDKYPNDSEMNISGNIFRIYEAP
AGTRCLEKWKRGIVNGRAALDDIGQVRPEKTQKAGEKLVGNCGAMGESPVDLRIESDVTD
TCLKPILNIPIEELSILDSVSISKCGRSRTEVNHLFNQKGATVQLQTKKEPLKPTGSSGN
RKGDKIAVSVNRVFAHQSELQIPQQENGNFTSCVTPVALLPAKAELLDLDDHSLQFCIPS
TIQKWLVFSYSVVQWMQFVEFMLIAVRAELPKSLPITCRQKGRYDRNVVILKDPMRRLWP
VFYHDKPVFVGFTAGWKPFAAANNLQAGDVCKFVKEMDEDELAFQVYITRK
Download sequence
Identical sequences A0A0D9YUH8
OGLUM02G23240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]