SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM03G24000.4 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM03G24000.4
Domain Number 1 Region: 124-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000001
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM03G24000.4
Sequence length 257
Comment pep:novel chromosome:ALNU02000000:3:21687715:21693272:-1 gene:OGLUM03G24000 transcript:OGLUM03G24000.4 description:""
Sequence
MEDAGTGSGEAWWRMQDGAVLERRARGDVRMRSASGGKRTVWSCTKSKPHFINGIGSSVS
DLGKHRTCPCLRMAPLCQSPRRLDLLTVKDGNTKRTLELCFCAKNVDPTADLKKYIEDLE
ECLDRSSKFYAVAVNNTFMKQDRVYFTKEFSKDYLKPLMDGKETISIGVQMAGGVSKNMM
LQMSTDDRCNLKKVWAKFATRNHIYLQSLCTFHFNKTTRLEATFDVLLPASLLRFTSKTK
VWPVEWSTTSFFLRPNI
Download sequence
Identical sequences A0A0D9Z9J9
OGLUM03G24000.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]