SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM03G27130.2 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM03G27130.2
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 522-605
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-19
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 3 Region: 223-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-18
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 4 Region: 726-831
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0097
Further Details:      
 
Domain Number 5 Region: 442-523
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000353
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM03G27130.2
Sequence length 838
Comment pep:novel chromosome:ALNU02000000:3:25439577:25450145:1 gene:OGLUM03G27130 transcript:OGLUM03G27130.2 description:""
Sequence
MAGGNTHRKKSCACCKEYLEHLGGKMRCFLRRMAADSMHSMIMPDRFVSHFGGKIPGTIK
LESPNGILYVVEVTECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRYEVLILDSDD
CEKVFSCAGIRNGSCVQDKTVDPVDSSGSSSNDTTQSSRSRNTENLTAMCSSSEKSGEDS
PSGYEFHESVEPQTPSGSDYVLSRRTYLSEAQKERVVAHIQDIQPEITVFVAVMKKCNLQ
SPAPYLVISSRYASVHFPRETATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWQNFVHD
NCLQEEDICLFVPTKGGRNFAFTVHLLQAEATHSRDGTDVHKIGSSQNKRNSKMASQVHI
EEAPGGDVSSESNKHGVSHESLESEDSDGPSEPPYISSMRRRLSQLQKKTVEEKVRAIQS
EIPICVATISKLAGSGGKGKFRGLELSSRYAASYLPDKNHQTLVLQCKGMIWQINLVVRR
RYTKGKRWFLTAGWRKFAHDNRLRVGDFCLFELKKKKKLTMEIIPDRFVNHFGGKIPGTI
KLESPNGILYVVEVTECMNKTVLQCGWEAFVDAHHIKVGDSLLFRHIENSCFEVMILDSD
GCERVFSCAGIKTNSCVHDKTVDPVDTSGRSSDDTAQPSRSERFARCQRDTSNDRRNTAS
LTAVSSSSEESENVSLKSNRNGVSDESQESEDSEGPAGPPYILSWKSKSRLSSLQKKIIK
EKVRSIQSEVPIYVAIMNKSNIGLTSSPCQLELGARYAAAVHLPDRRQAVVLQRMGQRWD
TVMQTKSGRCTTRRFLINGWSRFVRDNRLCVGDICLLELKKHESKLTMTVHTIFSQQS
Download sequence
Identical sequences A0A0D9ZAM7
OGLUM03G27130.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]