SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM03G28900.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM03G28900.1
Domain Number 1 Region: 264-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-16
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 65-185
Classification Level Classification E-value
Superfamily POZ domain 0.0000000306
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM03G28900.1
Sequence length 589
Comment pep:novel chromosome:ALNU02000000:3:27558910:27561472:-1 gene:OGLUM03G28900 transcript:OGLUM03G28900.1 description:""
Sequence
METSTISFSSSSPPSPPPPQPAPGDIDAVSLGRLSRNLENLLDPAFLNCADAEIVLASGG
GDPGGGAVVGVHRCILAARSRFFYDHFSSAPAPAPATAGDKPQLDLDGLVPGGRHIGRDA
LVAVLGYLYTGRLRSAPPEAAACLDDGCSHDACRPAIDFVVESTYAASGFQISELVSLFQ
RRLSDFVNKALAEDILPILVVASTCHLPELLNQCIQRVANSNLDNRYLEKRLPDDLYAKL
KEFRVPDEPHSGILDPEHEKRVRNIHKALDSDDVDLVGMLLKESPVTLDDAFAIHYAAAY
CEPKVLAELLTLESANVNLKNSSGYTPLHMACMRREPDIIVSLIEKGASVLERTQDGRDA
LTICKRLTREKDRNEKSEKCKERSKAYLCIGVLQQEIKRRPQILEDQMSAEESIATPLLV
DNFHMRLLNLENRVAFARIFFPSEAKLVMRIAQADSTQEFAGLTSANFSKLKEVDLNETP
TMQNRRLRERLDALTKTVELGRRYFPHCSEVLDKFLNEESTDLILLESGTAEDQQTKRMR
FSELREDVRKAFTKDKAAGAAISSSTSASSSPRYETKLRPGNKKGKLSR
Download sequence
Identical sequences A0A0D9ZBA5
OGLUM03G28900.1 OGLUM03G28900.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]