SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM04G10060.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM04G10060.1
Domain Number 1 Region: 90-189
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000334
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM04G10060.1
Sequence length 212
Comment pep:novel chromosome:ALNU02000000:4:16228186:16228944:-1 gene:OGLUM04G10060 transcript:OGLUM04G10060.1 description:""
Sequence
MRAATALPSIPSSSSPSPMASDPTELRCSSPESSGDAGAEDPAAVDAAEESGGEGGSGHI
AAGTEAAPPRPPEPEPEKVARHGVLPLLGKPYFTCIMCKSHVQPPFQVVVPRSFAPLLPS
RTTPATLSWRGRSWGMRFTGGRLIQRLEAGWRGFAVDNDLRLGDGCVFELLVGGGGEQER
VEFRVQVLRAEIPARIRGRAGGYTSATPIVID
Download sequence
Identical sequences A0A0D9ZJY6 A0A0E0GZV7 A0A0E0P899 Q7XLP4
LOC_Os04g31730.1|PACid:21891937 ONIVA04G08240.1 LOC_Os04g31730.1|13104.m03033|protein 39947.LOC_Os04g31730.1 XP_015635251.1.37577 OGLUM04G10060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]