SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM04G21110.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM04G21110.1
Domain Number 1 Region: 2102-2388
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-125
Family BEACH domain 0.00000000975
Further Details:      
 
Domain Number 2 Region: 2510-2579,2614-2729,2768-2815
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.83e-30
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 1987-2087
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000184
Family PreBEACH PH-like domain 0.003
Further Details:      
 
Domain Number 4 Region: 279-318,361-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000352
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM04G21110.1
Sequence length 2841
Comment pep:novel chromosome:ALNU02000000:4:25055919:25075485:-1 gene:OGLUM04G21110 transcript:OGLUM04G21110.1 description:""
Sequence
MAEEPRESLDSSPEPPPPGQDSDEQFSAVPLADEVRAEGSELDPDTSAGTSVAVTPARSE
PSPPPPRRRRPRPLGVPPDAPQEVVRAVDDAIMVGGGAAAAAGVDRLHEMVSEEQGELPL
TVVDVLLGTMGGADGLDEVEDKTGTGAPPSIMFNSRAAVVAAELLPYLPCGDEPSPRTRM
AVGIHATLRACTRNRAMCSSSGLLPVLLDSVEKLLIGMGRASSWDGTPLLHCIQLLGGHS
LSVKDLHSWLGLVKKALGTSWATPLMLALEKAMGSEEARGPAATFEFDGESSGLLGPGDS
RWPFSNGYGFATWIYIESFSDTLSTATAAAAIAAAAAATSGKSSAMSAAAAASALAGEGT
THMPRLFSFLSSDNQGVEAYFHGQFLVVESGGGRGKKASLHFTYAFKPQRWYFVGLEHTN
KHGLLGKGDSELRLYVDGSLHESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPL
FAEMGPIYIFREPIGPERMGRLASRGGDVLPSFGNGAGLPWRATNDHVKNMAEESFTLNQ
QIGGCLHLLYHPSLLNGRLCPDASPSGSAGTHRRPAEVLGLVHVSSRVRPAESLWALAYG
GPMALLPLTISNVQMDSLEPMLGELSIATASLSAPIFRIISLAIQHPGNNEELCRTCSPE
ILSRVLHYQLQAFPKMEGGEGEAVTDEELVDAIVSLCQSQRNNHELKVQLFSTLLLDLKM
WSSCTYGLQKKLLSSLADMIFTEAACMRDANALQMLLDSCRRCYWAIREPNSIDNFALTG
TKRSLGEINALIDELLVVVELLLGSASSTAASDDVRCLIGFVVDCPQPNQVARVLHLIYR
LIVQPNISRANMFAQSFISCGGVDALLVLLQREAKAGNNSILDNSDALLSENDFLRNDDS
DTKAASGEAKSQDDQIQSVELEQHESILHEEHTELGSTSTNDVPCEILGSSIGRKLSSSE
NQLLKNLGGINFSITADNVRNNVYNVDKGDGIVVGIIHILGALVASGHLKFASRAANPNL
PGGLLTTVHEEGNTMSEDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDEN
LNLYDCGHRFEHIQLLLVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSISEWPE
WILEVLIYNHEDVEATIHCAEWLSMVGGSSTGDQRIRREESLPILKRRLLGGLLDFSARE
LQVQTEVIAAAAAGVAAEGLSPEEAKTQAENAAHLSVALAENAIVILMLVEDHLRSQGQH
FCTSRSLDSAVPSASMVSSAASRSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLDVLTSM
ADSNGQISAAVMERLTSAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSK
SDTFGGGGSGWEFWKSVLEKDSNGTWVDLPLVKKSVAVLQALLLDDSGLGGGLGIGGGSG
PGMGVMTALYQLLDSDQPFLCMLRMTLVSMREDDNGEGDAFTGNISIKDVISEGLGHQAG
SMMPLDSNNRSSTRKPRSALLWSVLGPILNMPINESKRQRVLVASSILYSEVWHAIGRDR
SPLRKQYIELILPPFIAILRRWRPLLAGIHELTSSDGQNPLIADDRALAADALPIEAALS
MISPGWAAAFASPPVALALAMMAAGASGTEAIAPPRTLNRRDTSVPERKAAPKLQSFTSF
QKPIETAPNKHGSTPKDKAAVKAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSAGD
IERAKRWNTSEAMSAAWMECLQSVDSKSVSGRDFSALSYKYVAILVSGFALARNLQRVEM
ERQTQADVLNRHRVSTGVRAWRHLLHCLTEMDRLYGPFGEPLCAPDRIFWKLDFTESSSR
MRRFMKRNHKGSDHLGAAADYEERKLSNVAQSNECNPEGTEPLVTDTLPSTAPIITAEAM
SVDDRNEDNEQLESDTTQSSVDDRLQQADQQSVKGSIDSRGSGISADRNLVRSTVIAPGY
VPSDADERIIVELPSSMVRPLKVVRGTFQVTSKRINFIIDESANESNMDDHASTSGQCDQ
QDKDRSWLISSLHQIYSRRYLLRRSALELFMDMEARKNAYRAIVHSKPPNLNDIFLATQR
AEQILKRTQLTERWANWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEILNLD
DPCTYRDLSKPIGALNPERLEKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVEPY
TTLSIQLQGGKFDHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFANINSIDFGT
TQLGGKLDSVNLPPWAEDPVDFVHKHRKALESEHVSAHLHEWIDLIFGFKQRGKEAVMAN
NVFFYITYEGTVDIDKITDPVQRQAMQDQIAYFGQTPSQLLTIPHMKRKPLAEVLHLQTI
FRNPSELKSYLLPNPDRCNVPASTMFVSNDSIVVVDVNVPAAHVALHHWQPNTPDGQGTP
FLFHHGRNAANSTGGALMRIFKGSASSGEDYDFPRAIAFAASGIRSSAVVAVTCDKEIIT
GGHADGSVKLISPDGAKTIETATGHLAPVTCLALSHDSNYLVTGSRDTTVILWRIHQAGS
LHKKNAPEPPPTAPTTPRSPSVSNLTEIRRRRIEGPMHVLRGHLEEVTSCSVSPDLGLVV
SSSNMSGVLLHSLRTGRLIRKLNVAEAHAVCLSSQGVILVWNESKKRLSTFTVNGLPIAT
TVLSPFCGRVSCIEISTDGHFALMGTCSSSNYKCEDSTETGDHEPNEPNGKDGISKQAET
RQSVHVPSVCFVDLHKLKVFHTMELGKGQDVTAIALNKENTNLLLSTADKQLIVFTDPAL
SLKVVDQMLRLGWEGDGLLQS
Download sequence
Identical sequences A0A0D9ZP04
OGLUM04G21110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]