SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM04G25130.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM04G25130.1
Domain Number 1 Region: 879-1110
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000948
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 2 Region: 1352-1505
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000458
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number 3 Region: 256-514
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000283
Family Tropomyosin 0.0056
Further Details:      
 
Domain Number 4 Region: 505-716
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000981
Family Tropomyosin 0.0053
Further Details:      
 
Weak hits

Sequence:  OGLUM04G25130.1
Domain Number - Region: 1141-1340
Classification Level Classification E-value
Superfamily Tropomyosin 0.000291
Family Tropomyosin 0.0076
Further Details:      
 
Domain Number - Region: 684-905
Classification Level Classification E-value
Superfamily Tropomyosin 0.0141
Family Tropomyosin 0.00068
Further Details:      
 
Domain Number - Region: 103-302
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM04G25130.1
Sequence length 1871
Comment pep:novel chromosome:ALNU02000000:4:28393500:28402617:1 gene:OGLUM04G25130 transcript:OGLUM04G25130.1 description:""
Sequence
MEVEQAAEVGEVTAPKLPDKAVDKAQVHDDDKENLVNGNSNLQVKEAHNDEDDGTGSDGF
ELIDVKENFDSAKVVEEEKASPIEQGKTAALEEQALTRESAMLNQETKQLEELTRRIEEL
ELEKEKLVKGVTEAENKQNLHYTSLQEAQRSLADKDKELADATQSLKELGSELESSKERI
QEIEAELAASADKLHKLEELKDERSLHAAQEAKRASELDKTLETAQLNMKEMEAQISSLQ
EEIKGHQDKAIDHQQVEESLRSTLSELKMVQEALELSKSQVDDLEQKLASQDANISHLTE
ELSLHRSSEESLKEKTLKLENELSSAHEELQAKILNLQEMEIKLEEQAKEKQTWEATLEK
QQEQILNLQTELDESKGGNETLRGTIADLNSKLAERDSLLRQAEDEHAKAQLLLSEALSH
KDELEVNLKSINEQHGESRAAAENASQKILELEALLQTLHATEEALKLQLEEAEARVEVA
EKKGSDLEQLLGESENKLVASSGELKLLEERVQQEAASSAEKEKLLEEATNSVEAYKEKI
NELQASLDSTTSKNQLLEQEVKDLSDKFTEHQEQAHSVHERSLELESLLHTSKSDAEVAH
TRTQDLENELNTANEKFKEVEADLEQYRSKVSQLSDELEAYQTKAASLEAVMESASEKEK
ELVESLGQITEEKKKLELLVLEYEEKTEEYLKEKQSLEERLQSQESKVLALEESLVKMGE
EKESHEGTIADLNLQLSNKNDMYMQLESQLSQAGDDHSKTRSLLSEAQLHKEELELNLKS
LNDLHVESKTAAESALQRIAELETQVQELSAAEQSLKSHLTEFESKLASAEKKSMDLEQE
LKDATEECNSSRLRVDELSGELEEYKEKRTSLEASLLEAKQKEAELSEKLDQVNEEKEKF
EELSKKATIKHLEAENQVQALQGELESARHKLEEVESDLEALGIRETSVLDKLKSAEEQL
EHKGKALEHATSKKIDLEALYQSLLEDTEMKLQQAGENLTQKETECQELSEKLKAAEEQA
ASYQAKATAAAEEVESVKVELEAFETEISTLETTIEELKTKASNAESRAEQALVESAMMS
ETNQALKEDLDAKLAMLRELQEQFDSTHAEKEKVFTKLSAHEKTIEHLTEVHSRGLELHA
TAESKNAELEAQMHEALETIGKKDSEVKDLNERLAALESEIESLTHVNEAMKQEINAKLV
KVDELQEKLSSISSEKEEVAEKVVVHEKTIEHLREKHSRGLELQSAAESRSAEIENELRE
VLETVAQKEAEVTDLKEKLVSLETENEKLVGINEALKGELDTKVAMFDELQEQFSSTHAE
KEEAAEKLAVHERTISHLTEVHTRSLELHSAAESKNEEIESKLHEALEMAAQKEAEVKDL
SKKLDALEIELGYYEEQATEAAAAEETHKIKFDEAVHKIKSLEEQLAVTENKVELFHTEK
ENLVIANSKLNEELELHQNKLNELQVALAAAVAEKEGSSEEIHSLRKTLDGMIQRKEELE
SQLSLNSYIAITYFVALRKLSPCQVSSTVEEHEELKSKYNITLEEKQLLNEKYESAKKEL
GEAIAKLEEQMNVDKSEKELHISKLERQITLSELKYMEEIQTMQVETTEKDEALTTKMQE
HANLVHEKDALEQQLLEVRKELNDAYHTIANQEEQVSVREIKWDAYKKFSEDQLEAEQQH
VAELEVQVSSLKQQLQEAEIHYKHKEEQVSLREVQWEADQEHSVSELKAQRQYAAELEKQ
IGALTQQLQLVEKQYEQKVTEEREKLALVNTEVSKLTQKLSKSAEMEKKIEHLEQKLQAK
DSVESTSRDFSLDSSTLPSKQRDRSLAPETTPPNPTQQQELREPSGIMAFKFILGVALLS
VLIGVFLGKRY
Download sequence
Identical sequences A0A0D9ZQM3
OGLUM04G25130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]