SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM04G29460.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM04G29460.1
Domain Number 1 Region: 296-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-18
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM04G29460.1
Sequence length 433
Comment pep:novel chromosome:ALNU02000000:4:31740865:31744772:-1 gene:OGLUM04G29460 transcript:OGLUM04G29460.1 description:""
Sequence
MADTRGSTSSGGGDGRGREGHDDFAGGGQYNRYHRILEAVPSPLVRRENVAHHQYPTGLI
HHPSSTMPVAPCSYVPRYTMVPTSAMVPLQHHHRQLQISQENFQDRVPSNNVAAPHLPSN
FQDLRPMCNGPPFMSYGQTASNRNVLYQNLTPYSFNAWASNNMPRNPVYTSYHPTAIEDP
HATPFHINNHDTDQGFFTLSTSFRVDQSFVHAPSPFPPVSSSSRSFSSAQISNGPTHAKK
AKKSDIKDQPIVLRRSDTESEKNDELDQTPASEPSSMSHNSANLTIRFNCREYRVILRKE
LTNSDVGNIGRIVMPKRDAEAHLPALHQREGVMLKMDDFKLETTWNFKYRFWPNNKSRMY
VLESTGGFVKQHGLQTGDIFIIYKSSESEKLVVRGEKAIKPNVIMPIVDCSCKNDLNNSE
ECGFAISLLTKKT
Download sequence
Identical sequences A0A0D9ZSF4
OGLUM04G29460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]