SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM05G21650.2 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM05G21650.2
Domain Number 1 Region: 132-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-24
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM05G21650.2
Sequence length 279
Comment pep:novel chromosome:ALNU02000000:5:24045657:24049359:-1 gene:OGLUM05G21650 transcript:OGLUM05G21650.2 description:""
Sequence
MAAEAGSAAAGAAYEEERRKRVLENLKHLEDLGIKKMSKSLLEAARLQKSTRASPKPRKK
FEVGATEVRRSSRARNSVSYKENFDELDSFLRRRRGSRIRSTEQGRDYTGRVASYEQQQR
AFKKAERLQNSLDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKEYKMVLEDEEGG
EFDSVYIGNRTGLSGGWRGFAMHHNLEDGDSLVFELAEPDRFKIYIIKAVDEDANEPEPA
DEEAVGDKDTSTEDAAEQDDSPNAEPLKGAKRRKLRGRR
Download sequence
Identical sequences A0A0E0A0S3
OGLUM05G21650.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]