SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM05G23980.2 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM05G23980.2
Domain Number 1 Region: 120-281
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-39
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM05G23980.2
Sequence length 697
Comment pep:novel chromosome:ALNU02000000:5:26139159:26145180:1 gene:OGLUM05G23980 transcript:OGLUM05G23980.2 description:""
Sequence
MGIDLNTVEEEAEEGAAAAVCGELWHACAGPGVALPRRGSALVYLPQAHLAAGGGEVPPA
GAVAVPPHVACRVVGVELRADAATDEVYARLALVAEGEMLQQNFREGGGEDGAGEMEGCD
AEKKPRMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLVIHLKEKLVTFNDYKTVRPS
QELIAVDLHGTQWKFRHIYRGQPRRHLLTTGWSSFVNRKKLVSGDAVLFLRGDDGQLRLG
VRRAVQLRNEALFEPVNSSDSKLRILSSVASSLENKSVFHICFNPRSGASEFIVPYWRLL
KSLNHPFSIGMRFRVCYESEDANERSAGLISGISEVDPIRWPGSRWKCLLVRWDDSTDSS
HQNRVSPWEIERVGGSVSVTHSLSSGSKRTKLHFPQGSLDTPFLNGNGHPDSMGTENFHR
VLQGQEFRGSRSHGVVCSESPGVPNFQSPDNRRFSADMRGYMMPASGPPQRNTEFTYQPI
GFSESLGFPEVLQGQEMSQVDPLFRGATFGARTQNDRVVSANSVHRSAAQSGLLASTLGH
PISQFTLSSSKVSSPSSVLMFNQATAPNHETVGGTNNKGMHVSQFASQEMLSETVTWPGT
QLQTPSEITSNQFALARIPAAPSGAESGSPKRDAGRSSCRLFGFSLTGNMLGEDGEGLED
GAIEAGCENPPVLELFGHSHSTPGALHALCAAAPLGM
Download sequence
Identical sequences A0A0E0A1L0
OGLUM05G23980.1 OGLUM05G23980.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]