SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM05G27420.2 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM05G27420.2
Domain Number 1 Region: 136-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM05G27420.2
Sequence length 729
Comment pep:novel chromosome:ALNU02000000:5:28614707:28619864:1 gene:OGLUM05G27420 transcript:OGLUM05G27420.2 description:""
Sequence
MTGIDLNTVEEDEEEAAEEVAANGSSPAPARAGAVCLELWHACAGPVAPLPRKGGVVVYL
PQGHLEHLGDAPAAAAAAAAVPPHVFCRVVDVTLLADAATDEVYAQLSLVPEKEEVARRA
DDGEGEDGDGMKQRFARMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQ
ELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGELRLGV
RRAAQLKNGSAFPALYNQCSNLGTLANVAHAVATESVFNIYYNPRLSQSEFIVPYWKFMK
SLSQPFSVGLRFKMRYESEDATERRYTGIITGSGDTDPMWHGSKWKCLLVRWDDDAEFRR
PNRVSPWEIELTSSVSGSHLCTPHSKRLKPCLPHVNPEYMVPRGGGCPDFAESAQFHKVL
QGQELLGFKSHGGTAAATSQPCEARHLQYIDERSCSSDASNSILGVPRLGDRAPLGNPGF
SYHCSGFGESQRLQKVLQGQELFRPYRGTLVDASMGSNGFHQQDSSRAPGVVNKWQAQLH
GRAAFHGPPAPALPSQSSSPPSVLMFQQANSKMPRLEFGHGQLDKHENDRRVRFGPSEGI
ERREQRIPLQPYPTSGEVIDGQVTVEKSHSPGRHGKDGPDNKAVGTNSCKIFGISLTEKV
PAREELDDGDANYSLESLKQVPKSLGNSCATVHEQRPVVGRMVAEYQGDGGTDDSDIFIL
DVGVGALIM
Download sequence
Identical sequences A0A0E0A2T0
OGLUM05G27420.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]