SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM06G26560.2 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM06G26560.2
Domain Number 1 Region: 124-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-28
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM06G26560.2
Sequence length 698
Comment pep:novel chromosome:ALNU02000000:6:29063289:29067570:1 gene:OGLUM06G26560 transcript:OGLUM06G26560.2 description:""
Sequence
MITFVDSALKERERESDKCLDPQLWHACAGGMVQMPPVSSKVYYFPQGHAEHAQGHGPVE
FPGGRVPALVLCRVAGVRFMADPDTDEVFAKIRLVPVRANEQGYAGDADDGIGAAAAAAA
QEEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKF
RHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFMRTENGDLCVGIRRAKKGGVGGPEFL
PPPPPPTPAAGGNYGGFSMFLRGDDDGNKMAAAARGKVRARVRPEEVVEAANLAVSGQPF
EVVYYPRASTPEFCVKAGAVRAAMRTQWFAGMRFKMAFETEDSSRISWFMGTVSAVQVAD
PIRWPNSPWRLLQVSWDEPDLLQNVKRVSPWLVELVSNMPAIHLAPFSPPRKKLCVPLYP
ELPIDGQFPTPMFHGNPLARGVGPMCYFPDGTPAGIQGARHAQFGISLSDLHLNKLQSSL
SPHGLHQLDHGMQPRIAAGLIIGHPAARDDISCLLTIGSPQNNKKSDGKKAPAQLMLFGK
PILTEQQISLGDAASVAVKKSSSDGNAENTVNKSNSDVSSPRSNQNGTTDNLSCGGVPLC
QDNKVLDVGLETGHCKVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSHVFY
RDAAGALKHTGDEPFSEFTKTARRLNILTDTSGDNLAR
Download sequence
Identical sequences A0A0E0ADH2
OGLUM06G26560.1 OGLUM06G26560.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]