SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM08G00080.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM08G00080.1
Domain Number 1 Region: 205-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-16
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM08G00080.1
Sequence length 315
Comment pep:novel chromosome:ALNU02000000:8:72478:75794:-1 gene:OGLUM08G00080 transcript:OGLUM08G00080.1 description:""
Sequence
MGQMDGGDGGGGGHPYHYQALLAAVHQQTVPLPNPFPAPSSGFADWSASTSAFTSLAAHS
STAPSNAVHYSFSPCYAFWTHYMLNKNAYPTSFPAPHDDHLRLANNNHPRDAPGPASSYG
VESFTSPSMAPNICTHMPPIEGPISAKEDKKPEILPRVVKSSDELETRNSNVEFHSETVG
TLPESKQGHDSRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDP
LILHMDDMVLPVTWKFKYRYWPNNKSRMYILDSAGEFLKTHGLQAGDVIIIYKNLAPGKF
IIRGEKAIHQQTTNP
Download sequence
Identical sequences A0A0E0APS2
OGLUM08G00080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]