SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM08G09520.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM08G09520.1
Domain Number 1 Region: 240-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000589
Family B3 DNA binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM08G09520.1
Sequence length 445
Comment pep:novel chromosome:ALNU02000000:8:9562958:9564295:1 gene:OGLUM08G09520 transcript:OGLUM08G09520.1 description:""
Sequence
MSSRDTLPPPDLRHGGGGASDQTNSAVPVSETPMEDGGGAPAAAGSSNTAAPPQPPRLDG
PTLERELRRCNIKLGKQKVSGEASTATTEPPRKKLMHDGIRAAAAAAPPPRSPPTRRIIS
YMVTAAAPPERKKTAADDRFRNLGTCSAQLRRRLSELDATEPEFVCEKTLRMSDVHRNQN
RLLFSCKRKEDLDQCPITHLFTDKETQIVHKKDEIAVEKKKKKKIKKDEKKEIKKEEEKQ
IREKLGLKVTVFDQGGNEYGMTCRYLESNGGYRFIEGWGKFVETNGMAISDSQRWTRDVV
VKLLAFRSRRLARGAEQSDHPDGPIGFIVLHHENGSRGRGDNDNDNEEEEEEEYQGKAPP
ANPKKEKSNGKEEHVVRASTSSSSSSAEAAVGVVAPMHEVSAAPRNMLEEDACLGMVKLW
SDTGSSSSSSKYNGPESSEEKRKKD
Download sequence
Identical sequences A0A0E0AT92
OGLUM08G09520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]