SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM08G11390.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM08G11390.1
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-20
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 422-521
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-19
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 206-310
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000104
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM08G11390.1
Sequence length 567
Comment pep:novel chromosome:ALNU02000000:8:12364696:12367231:-1 gene:OGLUM08G11390 transcript:OGLUM08G11390.1 description:""
Sequence
MRKPCECCHTKMKFIWQMNGNFKHSMVIPDRFLSHFAAKSSGTITLETPNGNMYKVGVGK
NMKRTLLLSGWEAFVHANSIQENDFLSFRYRGSSRFAVTVFDASGLEKARTYIDILSSSD
DHTTQSSASDTSDECQKVRPNHHGKQAKKPSVSSSEDLSAEDGSSGHRSLESEDLGRFSS
PYYLPGHHKLAKEQKAELVALVDKIQPEICVLVIIMNKTNVKRHPDLVVPKDYALLHFPH
KNQIITLELPGKRKNWACKFRIRADGGGRHLYLGDFVHDNRILEGDLCILQPMTKNDASV
FTMTVHLIRKERTDIASSHQTRKINSGGISSSSHHDTTRHIHQLVCVCTNRMHVCNFIAH
SFHLPVETCVVCIGEGSPDENDSFKSDDLQTLPITDYVLSYKSYLSRAQTGQVIMLLGEI
RPKKPVLVAVMRKKNVQSSIPFLEIPKEYAAAHFPNESVAITLQMLGKNKKWHPRLCMEN
DKRIYMLRGHWLDFVLDNHVVEGDICLFEPMKGGKFLCSQFTSFAPRQLITRVELVFKGL
AQVMEEPIQRWHQVFILRKNQLMVWKA
Download sequence
Identical sequences A0A0E0ATY7
OGLUM08G11390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]