SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM09G03800.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM09G03800.1
Domain Number 1 Region: 709-807
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-22
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 222-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-21
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 1410-1508
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-20
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 4 Region: 581-686
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-17
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 5 Region: 1070-1176
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-17
Family B3 DNA binding domain 0.0087
Further Details:      
 
Domain Number 6 Region: 1190-1293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-17
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 7 Region: 918-1017
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-17
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 8 Region: 430-534
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000549
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 9 Region: 98-185
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000145
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM09G03800.1
Sequence length 1523
Comment pep:novel chromosome:ALNU02000000:9:5575748:5588250:1 gene:OGLUM09G03800 transcript:OGLUM09G03800.1 description:""
Sequence
MMNNTPCGHEGSMSYHDNHLQSPSESSSLFNISLPPHSPFQELSGVDSTSLLVSDPPNMQ
QFCLRCSWTNPKRLAKPSLAIASLSHQHLAFDKTRCMFILKIENDTLKTILKMFAKNVQG
LISGVAKLEVPDGKTYDVEISKEHNELVFRSGWEVFAIAYELEQGDILDFGYSGNSHFKV
QIFNPRASLMITIDNHPEGKVWMNKPSTTCMDCITNHYWLHMDDRERYFFKVMMSVSDVK
DELAIPKKFAANVRGKIPEQVRLEVSDGKMYNVQVTEEQDELVLRSGWANFSSTYQLKHG
DLLVFIHSGHSHFKVLIFDPSCTEKEFSCVVTDNTSHVHERSISHDNHLQSPRSEILGKN
YSLCSSRKRSRMNPADYPSQRPDVPSSEDIKDPMSSGGLQKSKKSCYVLPMLYNMTSAQE
AEVLALEKKIQPQIPLYITAMDKTSVASGSLVFCKDYAVRYLLDQNRTIKLCQSGGSKTW
DISLDMDTDDLYALSTGWLDFFRGNLLQEGDICVFEASKSKRGVALTFHPFKESHCPKSS
EYTLSTKSPTRRVPKRDYFATNLTNLTDQLERKVKNKIKFIQSDIPIFLSVMRSSNCTRQ
SSLCFSVKYASKYLPHKDQNMRLRLPETKYKCKAALHIDTSTNLHKLLKGWGKFVNDNKL
EIHDICLFQLMKNKKKLTVTVHIIRKGEMEKSHRVCKNCVANHYWLHMDNHGKSFIKVMI
TDFKNGVTIPAKFARNFGGQMSGTVKLETRNGKTYEVQVAKELNNLVLRSGWERFASAYE
LEKGDILVFIYSGNSHFKVWIYDPSACEKELPCIITEQLPRVQQRSISHNNHTQLKRNAK
SAKLYVDSSGHSKETSEINPANSPSWKPTERVPSSEELDEPVDLANVQKATKSFYSLPRM
CNMTSAQKAEVDALEKRIKPQIPLYITVMDKASATDGLLAISKDYAVSYLLDKNETIKLC
HSGRSMTWDISLDIDTDDQYALSTGWLDFIRNNHLQEGDICVFEASKNKRGVALIFHPLK
QSHHPKPPGCVPSTKFPRHGVSKPNYIVSRFTTLSGQLKIKVEAKVQAMQSEIPIFVAVM
RESFIRGRSRYMCFSAKYAAKYLPREKNKIMRLRLPNKSYRYKAVFKINNKVHKLGGGWG
KFVDDNKIKLGDICLFQLMKNKKKLMMMVMGEKGCESCRKWQEHYYREHMDVSRIRFFRL
MTGDFAHGISIPEKVAEIFSGQITKGFNLKSPSGETWRVGVAKVADELILKSGWEDFAKA
HELQENDLLFFTCNGHGNGSCSFDVLIFDASGCEKVSCFFTGKKNSYMCKNFNSIGGQVA
GQYLSSDSEDTSTPSVLIGSPHKASTSKKLSGKTKTNPRKEPEDPNCSHWHVIEEKNTDD
DEHADYHYTRFANYLTGEERDEIFSLVSLQPGNPVFVVVLQTAHVRRRNILIVPTRFAAD
HLERKSHDILLIRPNRKQKWSVKYYYLSNTTRGFNCHRWIKFIRENRLREGNVCIFELMK
GARRPIMTVHVIGKADNRFVLLG
Download sequence
Identical sequences A0A0E0B0J6
OGLUM09G03800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]