SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118442887|ref|YP_877213.1| from Clostridium novyi NT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118442887|ref|YP_877213.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.24e-36
Family Ribosomal protein L6 0.0000326
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.76e-26
Family Ribosomal protein L6 0.0000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118442887|ref|YP_877213.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Clostridium novyi NT]
Sequence
MSRVGRLPIEIPNGVNVTVTPENVVTVKGPKGELTKAMHEDMNIAVEENNIVVTRPSENV
QHKALHGLTRALINNMVVGVTQGYEKTLELVGVGYRAQLKGKDLTLNLGYSHPVEIKAVK
GVEYKVPEPTKVVVSGIDKELVGSVAANIRVWRKPEPYKGKGIKYAGEVIRRKEGKTGK
Download sequence
Identical sequences A0A072X1B0 A0A0A0IPZ9 A0PXW1
386415.NT01CX_1130 gi|118442887|ref|YP_877213.1| WP_011721225.1.12664 WP_011721225.1.24188 WP_011721225.1.42769 WP_011721225.1.57937 WP_011721225.1.66291 WP_011721225.1.69400 WP_011721225.1.95864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]