SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118444653|ref|YP_877410.1| from Clostridium novyi NT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118444653|ref|YP_877410.1|
Domain Number 1 Region: 81-470,507-554
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-70
Family Pyridoxal-dependent decarboxylase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118444653|ref|YP_877410.1|
Sequence length 578
Comment L-2,4-diaminobutyrate decarboxylase [Clostridium novyi NT]
Sequence
MKLTENKSELIWQKILREKVHPGFIIPWKEKNKEEEFKNVINDTLYTLNELKGSKEEGKS
FLGKSNCCISNYREINKVKRNANIPEKSSSIEEVIKSASKYFDGMFNWVHPKSMVNVAPP
AAIPSIAGSLMGAIFNPNIVEQEYSGNIAALEIEVAAIISKLVGYDYKKATGHFTFGGTG
AYLFATKLALTKLLGKESRKNGIRSDAQILVSNVGHYAMKNCSDWTGLGTNNVRNINLNE
DSSMDLNHLEEVMEQCYKEGKPIAMIVATMGTTDAFAVDNIKGIVEICDRFVRKHNLKKR
PFIYADAVIGWAWSVFNSYDFKENSMEFSEKTLRSIEKSVANIRNLNLADAIGIDFHKTG
FTCYNCSMICIKDCNDIDMLTRDKDQMAYLYHSSAYTPGEYTLECSRGGGYALSAWCNLQ
YFGLEGYRVILGNLIECEMSLRNVIKEEPNLVCVNEKDNGLVTLFRVYPDKLKENINKVN
FAEEQYKNEFTNPDYKEQLKKYNEYQNKIANELERMMFEENGPALSFTSKFRLSQYGEPI
AAIKAYPMSPYMNFSEERLKEDIIKYVLRAKENVDKKL
Download sequence
Identical sequences A0PYF8
gi|118444653|ref|YP_877410.1| 386415.NT01CX_1327 WP_011721418.1.12664 WP_011721418.1.42769 WP_011721418.1.57937 WP_011721418.1.66291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]