SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116628684|ref|YP_813856.1| from Lactobacillus gasseri ATCC 33323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116628684|ref|YP_813856.1|
Domain Number 1 Region: 128-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-43
Family Extended AAA-ATPase domain 0.00000659
Further Details:      
 
Domain Number 2 Region: 360-463
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-35
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116628684|ref|YP_813856.1|
Sequence length 464
Comment chromosomal replication initiation protein [Lactobacillus gasseri ATCC 33323]
Sequence
MDNTVLGGIFLFDLDKFWQFFNAEMKKSYSTVAYNAWFKNTKPISFNKKTKEMIIAVESP
VAKGYWEKNLASQLIQEAYAYADMEIQPKFEVAGKEGPERLVTPKPRIKTNQEILEDRRD
EFAQDLQLNSKYTFDTFVQGEGNKLAAGAALAVADNPGSFYNPLFIFGGVGLGKTHLMQA
IGHQMLAEKPHAKVVYIQSETFVNDFINSIKNKTQAEFRNKYRNCDLLLVDDIQFFSKKE
GIQEEFFHTFETLYNDQKQIVMTSDRLPTEIPELSERLVSRFAWGLQVEITPPDLETRIA
ILRKKAETDGLAIDDSTLDYIASQVDTNIRELEGALVKVQAHATIEREDINVDLAKEALA
DLKLVQKNRGLQISKIQEVVANYFQTSTTELKGKKRVKQIVVPRQIAMYLSRELTDSSLP
KIGQEFGGKDHTTVMHACDKISRALKTDAEIKAAVYDLKAMLEH
Download sequence
Identical sequences A0A249NMD2
gi|116628684|ref|YP_813856.1| 324831.LGAS_0001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]