SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116629177|ref|YP_814349.1| from Lactobacillus gasseri ATCC 33323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116629177|ref|YP_814349.1|
Domain Number 1 Region: 7-82,175-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.35e-49
Family Bacterial dinuclear zinc exopeptidases 0.00029
Further Details:      
 
Domain Number 2 Region: 72-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.02e-20
Family Aminopeptidase/glucanase lid domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116629177|ref|YP_814349.1|
Sequence length 361
Comment glutamyl aminopeptidase [Lactobacillus gasseri ATCC 33323]
Sequence
MKKEQEIEMLKEFSDANSTSGFEEEFVKLFSTYAKDTADITVDGMLNVYAAKKENKGDRP
VIQMDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKIKNRDGEYIPGVVATKP
PHFMTAAERNSIPEVADMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGK
DFDDRFGAGAMIGVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTGRKIKPDLCIVLESC
PADDTFEPEWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKNGIPYTRSVRTGGGQ
DGAAIYYEYGAPTIVIGIPVRYEHSPYCFSAYKDFKASVDLATAIIRDMTKEKLDSFKKV
I
Download sequence
Identical sequences A0A087QC68 A0A133P7T9
gi|116629177|ref|YP_814349.1| 324831.LGAS_0513 WP_003651208.1.12732 WP_003651208.1.258 WP_003651208.1.27557 WP_003651208.1.30511 WP_003651208.1.4060 WP_003651208.1.42744 WP_003651208.1.53875 WP_003651208.1.60404 WP_003651208.1.80685 WP_003651208.1.85201 WP_003651208.1.86573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]