SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116629418|ref|YP_814590.1| from Lactobacillus gasseri ATCC 33323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116629418|ref|YP_814590.1|
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Formyltransferase 4.06e-62
Family Formyltransferase 0.00000687
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.37e-26
Family Post formyltransferase domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116629418|ref|YP_814590.1|
Sequence length 314
Comment methionyl-tRNA formyltransferase [Lactobacillus gasseri ATCC 33323]
Sequence
MSSVIFLGTPNFGSVVLQGLIDQGYDVKAVVTQPDKRVGRKQVVHQSAVKQTALKHNLPV
YQPAKLSGSDELAELMKIEPDFIVTAAYGQFLPTKFLKSAKIAPVNVHGSLLPKYRGGAP
IQYSVLNGDKETGVTIMEMVKKMDAGDIFSQKALPIEDDDTSGTLFDKLSILGRDLLLET
LPKFIDGTVTRTPQNEDKVVFSPNISKEQEQIKLTMTAEQANNLIRALNPDPGAYVMLDG
KRFKIWKAKPLAEKTSFPAGTLVTNKKKFVISMAGGSELELLEVQPTGKKKMNIKDYLNG
QGSHFTSGEKIIDE
Download sequence
Identical sequences A0A087QCK6 A0A133PIU1 D1YG32 Q044H0
gi|116629418|ref|YP_814590.1| 324831.LGAS_0761 WP_003653401.1.12732 WP_003653401.1.258 WP_003653401.1.27557 WP_003653401.1.30511 WP_003653401.1.42744 WP_003653401.1.53875 WP_003653401.1.60404 WP_003653401.1.80685 WP_003653401.1.85201 WP_003653401.1.86573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]