SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116630129|ref|YP_815301.1| from Lactobacillus gasseri ATCC 33323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116630129|ref|YP_815301.1|
Domain Number 1 Region: 127-190
Classification Level Classification E-value
Superfamily TrpR-like 6.28e-17
Family SPO1678-like 0.057
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily TrpR-like 0.0000000000011
Family SPO1678-like 0.042
Further Details:      
 
Domain Number 3 Region: 64-115
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000209
Family SPO1678-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116630129|ref|YP_815301.1|
Sequence length 242
Comment transposase [Lactobacillus gasseri ATCC 33323]
Sequence
MKVGLFCMSRKSKFSYEIKLKAIKKYLNGEASVLSIAKLIGADESTLRHWIHAFKAQGPE
ALKPHNNNQRYSKEFKLKCVAAYLTGKGSYNSLTHKFCLRSSNQLKQWVIKYNSHQELKD
YNPAPEAYMTKIKKTTLEERKQIVEYCKDHEWNYKEAALKFGCSYAQVYNWSKKYREQGF
KSLEDRRGRHLKVTKLSETQRLKREVEQLKRENKLKDQQIAFLKKVKELERMCLLDNQSK
DK
Download sequence
Identical sequences A0A087QEW6 A0A133P4H8
324831.LGAS_1507 gi|116630129|ref|YP_815301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]