SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116629832|ref|YP_815004.1| from Lactobacillus gasseri ATCC 33323

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116629832|ref|YP_815004.1|
Domain Number 1 Region: 28-149
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000471
Family Apolipoprotein 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116629832|ref|YP_815004.1|
Sequence length 263
Comment cell division initiation protein [Lactobacillus gasseri ATCC 33323]
Sequence
MTLTPMDIHNKEFATKLRGYDSKQVDSFLDRIVDAYGDALDQIVDLKNENVELKKRVDKY
DKVKDSINESLISAQENAEEIKKKTNIEAQEIIKKANQDADDILKKAQDDGDKKRAELQS
QYDTLNHDYDLLKGKVEDFREAIQGMLKDQVKELSDSDWQYYLDKYYGRSRLYPADGSQP
VEDESIPDGPMDNEVAPQENVASANPEVDNNAVNEVNSVQEKEDKPGVLTGDSPVKESMH
ATEENTQRRNGPVIIFPDDLKNN
Download sequence
Identical sequences A0A087QDT6 A0A2I1RMX9
324831.LGAS_1197 WP_003647108.1.12732 WP_003647108.1.258 WP_003647108.1.27557 WP_003647108.1.30511 WP_003647108.1.4060 WP_003647108.1.42744 WP_003647108.1.53875 WP_003647108.1.60404 WP_003647108.1.85201 gi|116629832|ref|YP_815004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]