SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124266043|ref|YP_001020047.1| from Methylibium petroleiphilum PM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124266043|ref|YP_001020047.1|
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.83e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000234
Further Details:      
 
Domain Number 2 Region: 356-452
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.31e-18
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.001
Further Details:      
 
Domain Number 3 Region: 293-332
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000000392
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124266043|ref|YP_001020047.1|
Sequence length 466
Comment cytochrome B [Methylibium petroleiphilum PM1]
Sequence
MAEFKTAPADAPVAQKLMTWVDNRFPATKLYKEHLSEYYAPKNFNFWYFFGSLAMLVLVI
QIVTGIFLVMNYKPDASLAFASVEYIMRDVPWGWLVRYMHSTGASAFFVVVYLHMFRGLM
YGSYRKPRELVWIFGCAIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFAAVPFVGPDLA
LLIRGDYVVSDATLNRFFSFHVIAVPLVLLGLVAAHIIALHEVGSNNPDGVEIKQKKWPN
GTPMDGIPFHPYYTVHDILGVSVFLMIFSAIIFFAPEFGGYFLEYNNFIPADPLKTPAHI
APVWYFTPYYSMLRATTDFMVNVLAVLIAAGAVLAVLKGKFGGGAKIAVLVGGLVAIALL
KTFDAKFWGVVVMGGAVVILFFLPWLDHSPVKSIRYRPDWHKYVYGLFVLFFFVLGYLGI
QAPTDIGTLVSQIGTLFYFGFFLLMPWWSQLGTFKPVPDRVTFAAH
Download sequence
Identical sequences A2SE23
gi|124266043|ref|YP_001020047.1| 420662.Mpe_A0850 WP_011828450.1.77188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]