SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124266696|ref|YP_001020700.1| from Methylibium petroleiphilum PM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124266696|ref|YP_001020700.1|
Domain Number 1 Region: 120-273
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.9e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 410-558
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.41e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 261-275,318-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124266696|ref|YP_001020700.1|
Sequence length 569
Comment nitrite/sulfite reductase [Methylibium petroleiphilum PM1]
Sequence
MYQYTPFDRAFVHQRAAQFRDQLERNRAGTLGDDEFRPLRLQNGWYIQRHAPMLRVAVPY
GELSSRQLRQLARIAREFDRGYAHFTTRQNVQYNWIPLDRSADVMDLLADVDMHGIQTSG
NCIRNTTSDALAGVAPDEIVDPRPYCEILRQWTTLHPEFAFLPRKFKIAVTGATEDRAAT
AWHDIGLHLHKNDAGEVGFRVLVGGGMGRTPIPGVVIREFLPWHQILVFIEAIVRVYNRY
GRRDNMYKARIKILVKAEGERFIEQVGKEFEAILSRDVDGDAQLIPESELDRVSACFVLP
EGVVAHASAGDGAPADAPVAYRKWLERNVHGHRLAGYRAVTLSVKRAGQAPGDATDTQLD
LAADLADRYSHGETRVTHDQNLLLPWVREEDLYALWRAARDAAYATPNIGLLSDMIACPG
GDFCGLANARSIPVAEQITERFADIDELYDIGDIDLHISGCINSCGHHHSGHIGILGVDK
DGAEWYQVTLGGSDGSALSGGLASAVPGKVIGPSFAADEVADAVEAVIETYRGQRAANER
FIDTVRRVGLEPFKTAANAVRRSTAKVAA
Download sequence
Identical sequences A2SFX6
420662.Mpe_A1503 gi|124266696|ref|YP_001020700.1| WP_011829102.1.77188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]