SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124267001|ref|YP_001021005.1| from Methylibium petroleiphilum PM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124267001|ref|YP_001021005.1|
Domain Number 1 Region: 208-340
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 0.000000000000301
Family Cell-division protein ZipA, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124267001|ref|YP_001021005.1|
Sequence length 359
Comment hypothetical protein Mpe_A1811 [Methylibium petroleiphilum PM1]
Sequence
MSTLQLSLAILGGLVLAAIVAHGTWQARRNEVKRVALEPGAEPAPLQEPSFAPTEPPRAD
DTGPKAEAEDSQPPRIEPTLVRRAAGLPRLDALIDAIATLTVDNPVSGETAIAHLPPARR
AGSKPLLVEGLNAESGEWETPAAGQRYGEFQAGVQLANRSGALNEIEYSEFVQKVQAFAE
PIGALPDFPDMLDVVARARELDAFAGQHDAQLALRLVSRGAAWSLGYVQQHAARHGFMVG
ALPGRLVQPGEDEGAPPVLTLQFDPQAALADEPSQAAVRELTLAFDVPQTAAAAAPFAAW
CAAGEALAAELDAAMYDDSGQPLQPAAFASIGQALESLYEALAARDLAAGSAATRRLFS
Download sequence
Identical sequences A2SGT1
gi|124267001|ref|YP_001021005.1| 420662.Mpe_A1811 WP_011829407.1.77188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]