SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124268783|ref|YP_001022787.1| from Methylibium petroleiphilum PM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124268783|ref|YP_001022787.1|
Domain Number 1 Region: 411-452,492-552,600-817
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.07e-81
Family Acetamidase/Formamidase-like 0.00032
Further Details:      
 
Domain Number 2 Region: 272-322
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000161
Family AraC type transcriptional activator 0.02
Further Details:      
 
Weak hits

Sequence:  gi|124268783|ref|YP_001022787.1|
Domain Number - Region: 87-130
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00459
Family Gentisate 1,2-dioxygenase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124268783|ref|YP_001022787.1|
Sequence length 844
Comment AraC family transcriptional regulator [Methylibium petroleiphilum PM1]
Sequence
MLDDLRRFSTDAFPEDLRPAAWAEVMAKVLMAPAAPAYDAPPLAGYVSARSSALESVFAR
LGSSPQVWLPHPGNARRGGHTVLMLALLEGSGLVVEGQESVALAAGGIVLLDPARPWRVE
LNTDFRAVVIRLESASFVLRLVRTSGQDLNTISPKTGVGAVCLNLVRSIADELDQLGRHE
LLPIEATLMELLVTCLSHVDDEDAQAAASPDDSTSVQLGHLRRVCRTVEARLGDAELTLE
AIAALEGLSPRYIQKLFKAASASFGEYLKARRLERCRLDLANRALAHFTIAELCFRWGFG
DAANFSRAFTARFGVSPKAYRAAPPADAAAGPTQRGAPAAGVATASSARAAAVADTPEAR
RRQFEAVLTDHERYALALALAPKRAVPHAAEAGFPEALPGAGHAPEYHYIPVSDRTVHWG
YLSRTLKPVISVRSGDVVTIETLTQHASDDRERMIDGDPGAESVFHWTATRKAVARRGAG
PMDASVFGRGAGEGFGVHICTGPVHVRGAETGDVLEVRILDIRARPSCHPQHRGKLFGSN
AAAWWGYQYHDLLTEPKKREVVTLYELQTDVAEPYAKAVYSFRWTPQTDPDGVRHETIDY
PGVPVDPASVDKRYGVLAKARVPIRPHFGLLAVAPKESGLIDSVPPGYFGGNLDNWRAGK
GARLFLPVSVEGALFSVGDPHASQGDGEVCGTAIECSLTGSFQLVLHKRAQIADGFLADL
NHPFLDAEDAWVVQGFSFANHLAELGAQAQTQVYQKSSLDLAMRDAFRKARRYLMQAHGL
DEDEALSLMSVAVDFGVTQVADGNWGVHAVIRKAIFPPQAEGDGAGAAPASSSAPAQPLR
NRKL
Download sequence
Identical sequences A2SLW3
WP_011831172.1.77188 420662.Mpe_A3599 gi|124268783|ref|YP_001022787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]