SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124266111|ref|YP_001020115.1| from Methylibium petroleiphilum PM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124266111|ref|YP_001020115.1|
Domain Number 1 Region: 432-526
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124266111|ref|YP_001020115.1|
Sequence length 577
Comment sulfate transporter [Methylibium petroleiphilum PM1]
Sequence
MVNRRSLRADLLAGLTGTIILVPQAVAYASIAGLPPAYGLYTAIVPVIVAALFGSSLHLV
SGPTAALSIVIFATLSPLAEPGSAAYIQLALSLTFMTGLLMLAMGLARLGVLVNFISHSV
VIGFTAGAAVLIATSQLKNFFGITAPASASFIETLRLFVQRLPDTNVHVLSVGIVTLLAA
VGTRTWLPRAPHMIVAMAVGSLHALALTALFGPQTGIAMVSAIPRSLPPLSMPIPSGETL
RQLAPIALALAMLSLTEAVAIARAIALKSGQRIDSSQEFIGQGLANVVGSFASSYVSSGS
FTRSGVNHTAGAKTPLAPVFSALFLVLTLVALAPLVRYLPIASMAAILLVVAYSLVDVHH
IRGILRTSRAEAAVLAATFLATLFLHLEFAIYVGVLLSLMVFLERTARPEIRDAVPAPGA
HSYHFVPQTDEPDCCQLKMVFIDGPIYFGAVDHVQRRLRDIDAADPGHKHLLVLAPGINF
IDSSGAELLGQEARRRRQLGGGLYFHRLHPSAVDVLARSGHLDAIGRENLHAIGSNVIDA
LYPRLDPQICRRCPARIFSQCQRTLPDGTPREPAGTP
Download sequence
Identical sequences A2SE91
420662.Mpe_A0918 gi|124266111|ref|YP_001020115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]