SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147672231|ref|YP_001214919.1| from Vibrio cholerae O395

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147672231|ref|YP_001214919.1|
Domain Number 1 Region: 64-118
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 9.16e-16
Family Outer membrane lipoprotein 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147672231|ref|YP_001214919.1|
Sequence length 119
Comment major outer membrane lipoprotein [Vibrio cholerae O395]
Sequence
MRASFARNCDYNNSVHILIFDKYRTSITPTYQVKEFSMNKMLIAAAASSVLLLAGCASGP
DEATTAKMNEISTQVSELNSQVAALASKVDQAAEAAKAAQEEAARANERIDNIAQSYTK
Download sequence
Identical sequences A0A0H3AEE5 A0A0X1L1S4 C3LU85 Q9KNA6
gi|147672231|ref|YP_001214919.1| gi|147672231|ref|YP_001214919.1| 243277.VCA0059 345073.VC0395_0078 579112.VCM66_A0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]