SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153954012|ref|YP_001394777.1| from Clostridium kluyveri DSM 555

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153954012|ref|YP_001394777.1|
Domain Number 1 Region: 65-168
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000759
Family Apolipoprotein 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153954012|ref|YP_001394777.1|
Sequence length 174
Comment hypothetical protein CKL_1387 [Clostridium kluyveri DSM 555]
Sequence
MDVIKLLEYLQEIVDTSAKVPLSKKVMVNKSEVLEILDRVINCLPSELKKAQWIIEEKER
ILTEAVQEADDIKKQNLSLLRRQIENHDITKEANIRAEEIISSAQKNARAIRIGARDYAD
EMLSQLDSEISRKGSEMVTGLKLELQEFLDSLESSINLNTESIKDNIKQLRDMK
Download sequence
Identical sequences A5N7Z8 B9E1F9
WP_012101776.1.77168 WP_012101776.1.89246 431943.CKL_1387 583346.CKR_1283 gi|219854626|ref|YP_002471748.1| gi|153954012|ref|YP_001394777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]