SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153953618|ref|YP_001394383.1| from Clostridium kluyveri DSM 555

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153953618|ref|YP_001394383.1|
Domain Number 1 Region: 84-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000785
Family NfeD domain-like 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|153953618|ref|YP_001394383.1|
Domain Number - Region: 5-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00759
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153953618|ref|YP_001394383.1|
Sequence length 141
Comment hypothetical protein CKL_0993 [Clostridium kluyveri DSM 555]
Sequence
MYNSIILWAIIGIAALSVDIITSSFLFVWFTVGAIGAIIAEILNYPFITQFMVFLVISVV
LIAICYPIVKKNIKKYVKPTPLREETYVGKEVIVDEEMVKNKALRIDGVYWNIKNQGDTL
KKGDTVKVTALEGNRLIIKKI
Download sequence
Identical sequences A5N6V4
WP_012101365.1.77168 WP_012101365.1.89246 gi|153953618|ref|YP_001394383.1| 431943.CKL_0993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]