SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|565993039|ref|YP_008912833.1| from Paenibacillus polymyxa CR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565993039|ref|YP_008912833.1|
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|565993039|ref|YP_008912833.1|
Sequence length 119
Comment PTS cellobiose transporter subunit IIA [Paenibacillus polymyxa CR1]
Sequence
MDEYQEIIMGLITNSGIAKSKAMEAISFAEKGNAEQAAECLEECKNELVQAHKSQTRLIQ
QEAGGTAHEVTLLMVHAQDHLMSAITTKDLARHIVELYSRLNRYEATVSITPLSGRNNQ
Download sequence
Identical sequences A0A0K2FB34 A0A1C3CDS6
WP_023989372.1.12882 WP_023989372.1.1883 WP_023989372.1.21208 WP_023989372.1.44575 WP_023989372.1.6981 WP_023989372.1.74614 WP_023989372.1.77953 WP_023989372.1.78517 WP_023989372.1.82066 WP_023989372.1.90060 WP_023989372.1.91807 WP_023989372.1.94972 gi|565993039|ref|YP_008912833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]