SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512581560|ref|YP_008095203.1| from Pseudomonas putida H8234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512581560|ref|YP_008095203.1|
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-25
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|512581560|ref|YP_008095203.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas putida H8234]
Sequence
MAKVGSYSATAKWLHWGMGLIWISAWSIGIMATHWRDELNAHHELTFLHKAMASTLLFLV
VARIAWRLTHPAPALPDSMSTLMKRGAFVGHLLLYSVALLALPISGWYWSSVADKPIMVA
GLFVLPPLVDPDQSLYDLAKGIHTYAAWLCGALVGGHILIALKHHFIEKDEVLAGMLPAR
DVR
Download sequence
Identical sequences R9VF05
gi|512581560|ref|YP_008095203.1| WP_016487123.1.68951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]