SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512580069|ref|YP_008098031.1| from Pseudomonas putida H8234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512580069|ref|YP_008098031.1|
Domain Number 1 Region: 223-267,299-533
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-47
Family CoA transferase alpha subunit-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512580069|ref|YP_008098031.1|
Sequence length 618
Comment acetyl-CoA hydrolase [Pseudomonas putida H8234]
Sequence
MHLCSIDQAVEQVLSRLPAHIHMGLPLGLGKPNAFVNALYARVRELPERQLTIYTALSLG
RPPLGDGLQRRFLEPFVERVFADYQELDYLADLRNDSLPANIRVEQFFMQPGSLLHSEAA
QQDYISSNYSHAARDINAKGLNLVAQLVAATPERPVHLSLACNPDITLDLLPMIAKRRAA
GETILMLGQVHAELPYMPGDAELPIDAFDLLLDEAEQRRLFSTPNMPVGTQDHCIGLHAS
TLVRDGGTLQIGIGAMGDAVAAALLARQGDNAGYRTLLDELDTGPWHALIEREGGLGTFA
QGLYGCSEMFANGLLVLAEAGLLRRPADEQGPVVHGGFFLGPQAFYQRLREMPLEARARF
AMTRISFINELYGQEELKRRQRRDARFINTAFAMTLLGAGVADQLEDGRVLSGVGGQYNF
VAQGHALEGGRSILLLRSWREAGGEVTSNLLWTYGHCTIPRHLRDIVVTEYGIADLRGQT
DSEVIARLLAVSDSRFQQGLIEQAKEAGKLPKGFELDARFTDNTPQRLEAIRARHARLFP
EYPMGTDFTAEERDLLRALNWLKSKFKLSEVLELGKAALDAPGPEGYQGHLERMGLDAPQ
GLKEELYQRLLLAGLAAT
Download sequence
Identical sequences A0A1L7NLR2 R9VBC6
WP_016489801.1.17209 WP_016489801.1.68951 WP_016489801.1.79655 WP_016489801.1.99808 gi|512580069|ref|YP_008098031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]