SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134096821|ref|YP_001102482.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134096821|ref|YP_001102482.1|
Domain Number 1 Region: 38-88,223-462
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.55e-62
Family Bacterial dinuclear zinc exopeptidases 0.0000184
Further Details:      
 
Domain Number 2 Region: 94-208
Classification Level Classification E-value
Superfamily PA domain 5.1e-17
Family PA domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134096821|ref|YP_001102482.1|
Sequence length 513
Comment aminopeptidase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MRTITSGRVTTAVLASCAALAVAVAPASAAPSRDLGDRISGNAVNRHLVALQRIADQNGG
NRASGRPGYEASVDYVANKLRSAGFDVTTPKFEYQAYYLDKFGLAVAGQPVEGDALEYSP
ATPQGGLTAPLSVLPPDPTPGCEATDYQGTDVSGTVVLIQRGTCSFADKQRIASEAGAVG
AIIYNNVDGALNGTLGDPADARIPTAGVTKQVGEALAGQAGAEVHLDVQSRLETVKTRNV
VAQTRTGRADNVVMAGAHLDSVPEGPGINDNGTGSAGLLETALRLGSTPKVNNAVRFAFW
GAEESGLVGSTKYVQGLSFEQQLDIALYLNFDMIGSPNAGYFAYDGDNSDGVGAGPGPQG
SAQIERDLVDAMAANGVQTEGKDFDGRSDYGEFIAVGIPAGGLFTGAEGIKTPEQAAKWG
GEAGKAYDPNYHMPGDTLANVDRVALERNAKAVASVVQRYAASTEGVNGVQTRAQRAQLR
GAEGALTAQRVATAEPEQHAHGADAHGCGRDRA
Download sequence
Identical sequences A4F682
gi|134096821|ref|YP_001102482.1| 405948.SACE_0204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]