SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134098270|ref|YP_001103931.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134098270|ref|YP_001103931.1|
Domain Number 1 Region: 25-303
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.05e-60
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000615
Further Details:      
 
Weak hits

Sequence:  gi|134098270|ref|YP_001103931.1|
Domain Number - Region: 309-435
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000153
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134098270|ref|YP_001103931.1|
Sequence length 552
Comment cytochrome b, membrane protein [Saccharopolyspora erythraea NRRL 2338]
Sequence
MSSITTPTKSESAVYKKAATAADELDQRFRFAKGMRRQLNKVFPTHWSFLLGEIALYSFV
LLLLTGVWLTLFFDPSMEEVVYDGVYRNLQGVEMSKAFASTLDISFEVRGGLFIRQLHHW
AALIFVASMMAHMARIFFTGAFRKPRESNWTIGALLLILGMFEGFFGYSLPDDLLSGTGI
RATLSGIVLSIPLLGTWLHWALFGGEFPGMEIIPRLYVLHVLLIPGIMLGLIAAHLALVW
YQKHTQFPGVRRKETNVVGIRIMPTFAVKGGSLFAVVTGVLAIMSGLFQINPIWNLGPYN
ASQVSAASQPDWYLAWADGILRVWPAWELYLGPYTVPPVFFAGAIGMGILFTVLIAYPAI
ERKLSKDDAHHNLLQRPRDVPVRTSLGMMALSFFMVLMISGNNDVIAFQFNISLNAMTWF
GRLGLLLLPPIAYWVTYRICLGLQRADREVLEHGVETGIIKRLPHGEFIEIHQPLGPVDE
HGHPEELPYQGAPVPKKMNKLGAAGHPVPGSLLKPDPQEETEALERALHEDAEREREERE
QRELISGKPKVD
Download sequence
Identical sequences A4FAD1
405948.SACE_1687 WP_009943855.1.17192 WP_009943855.1.58781 WP_009943855.1.76288 gi|134098270|ref|YP_001103931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]