SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134098988|ref|YP_001104649.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134098988|ref|YP_001104649.1|
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Rv2632c-like 2.09e-31
Family Rv2632c-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134098988|ref|YP_001104649.1|
Sequence length 89
Comment hypothetical protein SACE_2426 [Saccharopolyspora erythraea NRRL 2338]
Sequence
MVSTEHWSVDIYLDEDEERTHAEARLHTRDATDLRGRGLAKRNPHDRDVPEIGAELAAAR
ALFELAHHLLRAATEDVEQATGRPAHLHS
Download sequence
Identical sequences A4FCE9
WP_011873678.1.17192 WP_011873678.1.58781 WP_011873678.1.76288 gi|134098988|ref|YP_001104649.1| 405948.SACE_2426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]