SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134099533|ref|YP_001105194.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134099533|ref|YP_001105194.1|
Domain Number 1 Region: 22-344,379-459
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.57e-19
Family Soluble quinoprotein glucose dehydrogenase 0.0028
Further Details:      
 
Domain Number 2 Region: 678-805
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.83e-16
Family Family 6 carbohydrate binding module, CBM6 0.00087
Further Details:      
 
Domain Number 3 Region: 482-572
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000732
Family PKD domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134099533|ref|YP_001105194.1|
Sequence length 827
Comment glycosyl hydrolase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MAAAVLATTAMTAATAVAAPPPPAPPDTAFDQITLAKGESKVGEPMALAVLPDRRVLHSS
RDGAVFLTTPDATTVRAGTIPVYNHDEDGLQGIAVDPDFVRNRWVYVYYAPPLDTPAGDA
PEEGTPQDFAPFEGHNLLSRFKLTDAGTLDMASEQAILRVPTQRGTCCHAGGEIDFDARG
NLLLSTGDDTNPFSSDGYAPIDERPDRNPAFDAQRSSANTNDLRGKILRIDVQDDGTYRI
PQGNLFPAGTDKTRPEIYAMGFRNPFRFTVDRETGWIHLGEYGPDAGSADPARGPGGLVE
YNVIKGPGNYGWPYCIGDNQPFVDYDFATGQSGQPFDCAAPKNLSPHNTGLVDLPPVQPA
WLPYDDDSVPELGSGPESPMGGPVYRFDPSLKSPVKFPRYFDGKVLNYEWDRGWIKEFTL
GREGELQGIRPFFESMELVRPMNIEFGPDGALYVLDYGSSYFGGAPDSALYRIDQNPGSK
TPKVQVSADKVSSGQAPLTVNFDPAGTEDPEGGQLSYAWDFNNDGTVDSTEAGPVSFTYD
QRGAHTAKLAVTDPDGRTGYASVQIVVGNTPPQVEIELPPDGGVFAFGEQVPFRVRATDA
EDGEIDCSRMELSYALGHDSHAHPLSEESGCEGVIETPADEGHGLDADVFGVITASYTDN
GAEGLPPVEGSGRVTLQPKHKQAEFFTESQGVEVVEEAGAEGGSKVGAVDDSDWISFSPV
NLTGIDGIGYRVSAAGPGGTIEVRAGAPDGELLHTAQVPTTGGGDRYVDIEPVAVTAPGT
PGPLFLVFRGGGTGLFELDAVKFHGAGVSQPVPPDDAAARAQGDLPR
Download sequence
Identical sequences A4FDZ4
gi|134099533|ref|YP_001105194.1| WP_009951114.1.17192 WP_009951114.1.58781 WP_009951114.1.76288 405948.SACE_2991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]