SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134100700|ref|YP_001106361.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134100700|ref|YP_001106361.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.58e-107
Family FMN-linked oxidoreductases 0.0000000053
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000173
Further Details:      
 
Domain Number 3 Region: 463-521,556-653
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.56e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134100700|ref|YP_001106361.1|
Sequence length 675
Comment 2,4-dienoyl-CoA reductase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MSEFPHLLSPVDLGFTTLRNRVVMGSMHTGLEDRAKDFPRLAEYFAERARGGVGLMVTGG
FAPNRTGWLYPFASKLTTRAEARRHRLVTDAVHEAGGKILVQLLHAGRYAYHPLSVSASA
VKSPINPFRPRALSDRGVRAQIRAFARAARLAREGGYDGVEIMGSEGYLINQFLAPRTNL
RTDRWGGSAENRRRLAVEIVRRCRQAAGDDFIIMYRLSALDLVDGGQTWQEVVDLATAVE
EAGATIINTGIGWHEARVPTIVTSVPRAAFTGVVGKLRPHVSIPVVASNRINMPQVAEEV
LSRGDADLVSMARPLLADPAWVAKAGEGRTDEINTCIACNQACLDHTFSQKKASCMVNPR
AGNETLLNLLPARQAKKVAVVGAGPAGLSAAVGLASRGHRVELFEADGEIGGQFGIARRI
PGKEEFAETIRYYRRQIELTGVGLHLNTRVAAADLVDGGYDEVVVATGVAPRVPDIPGID
HPSVLSYVDVVRHGRPVGERVAVIGAGGIGVDVSEFLTHAESPALDLEAWNAEWGVTGSE
DAPGGLTERRPEPSPRQVYLLQRKTSRIGRGLGKTTGWVHRAALKAKRVEQLTGVNYEKI
DDAGLHISFGPERERPRVLEVDSVVVCAGQESVRDLVDELTVKGVLTHVIGGADVAAELD
AKRAIDQGTRLAAAI
Download sequence
Identical sequences A4FHB1
gi|134100700|ref|YP_001106361.1| WP_009946761.1.17192 WP_009946761.1.58781 WP_009946761.1.76288 405948.SACE_4167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]