SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134101521|ref|YP_001107182.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134101521|ref|YP_001107182.1|
Domain Number 1 Region: 126-288
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.97e-27
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.059
Further Details:      
 
Domain Number 2 Region: 55-107
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000278
Family AraC type transcriptional activator 0.02
Further Details:      
 
Domain Number 3 Region: 4-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000806
Family AraC type transcriptional activator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134101521|ref|YP_001107182.1|
Sequence length 289
Comment AraC family transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
Sequence
MISALNRLVDLVEEHLAEEFDVDAAARSLGTTEYHLRRMFSSLAGMPLSEYVRRRRMTVA
AADLVRDEDDLLSIAVRYGYGSTEAFGRAFRAVHGARPSDVRRDGGPLRTQPQIRFRLTV
EGSIPMDTRIVERPAFRLVGHAARVPLIHRGINPHIQRHIAALAQEEHARLKALGDTEPG
GLLQVCDDLDPDGTEGSELTYLHGVAVSQATPAPGDLDAIEVPAGRWAVFHTAGPHPQTL
QEAWAATATEWFPSNPWRLRPGPSIVAVLDRADDFSTATCELWLPIEPA
Download sequence
Identical sequences A4FJN2
WP_009951429.1.58781 WP_009951429.1.76288 gi|134101521|ref|YP_001107182.1| 405948.SACE_4993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]