SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134101722|ref|YP_001107383.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134101722|ref|YP_001107383.1|
Domain Number 1 Region: 11-329
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.23e-102
Family DAK1 0.00000139
Further Details:      
 
Domain Number 2 Region: 364-569
Classification Level Classification E-value
Superfamily DhaL-like 2.35e-46
Family DhaL-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134101722|ref|YP_001107383.1|
Sequence length 576
Comment dihydroxyacetone kinase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MTRLYDDPASFTEDMVAGFVAAHPRYVRPVPGGVVRSRRGRQGKVAVVTGGGSGHYPAFC
GVVGPGFADGAVIGNIFTSPSSEDAYSVGRAADSGGGVVFSFGNYAGDNMHFGLAVERLE
RAGIRAHNVVVTDDVASAPVEERSKRRGVVGDFVVFKVASAAAEEGYDFDEVVRVAEHAN
DRTRSLGVAFDGCTLPGQDEALFHVPDGKMGLGLGIHGEPGVSERDMPSASELAKILVDG
VLAEAPEGATPRVTAILNGLGATKYEELFVVWGTVSRLLAEAGVEVVEPEVGELVTSLDM
AGCSLTLTWLDPELERLWSAPADTPAYRKGNAVTVSEPESTEVVESAPIDEPIVVVAPAE
GQATAATVVRALHSVADALRDAEDELGRLDAIAGDGDHGRGMTKGSAAAVEAADAVLAQG
VGPAAVLVAAGDAWAAKAGGTSGALWGAALRSFGDLLPDDRPATAEDLAAGAAAALGAVQ
RLGRAEVGDKTLVDALIPFVDALKDAVADGSRGRDAWQQAAQEATRAAERTAELTPRTGR
ARPLAERSVGTPDPGATSLALALSEIAGVLTGEGVH
Download sequence
Identical sequences A4FK83
gi|134101722|ref|YP_001107383.1| 405948.SACE_5217 WP_009942400.1.17192 WP_009942400.1.58781 WP_009942400.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]