SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134102684|ref|YP_001108345.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134102684|ref|YP_001108345.1|
Domain Number 1 Region: 5-207
Classification Level Classification E-value
Superfamily DhaL-like 8.76e-54
Family DhaL-like 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134102684|ref|YP_001108345.1|
Sequence length 212
Comment dihydroxyacetone kinase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MGCTAQDVVAALRAGAEIVAAHREELIRLDREIGDADHGENMDRGFRAVVSKVDTAAPET
PGAVLKMVATVLISTVGGASGPLYGTAFLRAAAAVGDAAELDGPAVAAALKAGMEGVAAR
GKAVTGDKTMIDALSPAVDAAKAAADAGEGPVKVLSVAAEAAHVGAQATEPLVARKGRAS
YLGERSAGHIDPGARSTALLLSAFSEAARGGR
Download sequence
Identical sequences A4FMZ5
WP_011874992.1.17192 WP_011874992.1.58781 WP_011874992.1.76288 gi|134102684|ref|YP_001108345.1| 405948.SACE_6247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]