SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134102990|ref|YP_001108651.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134102990|ref|YP_001108651.1|
Domain Number 1 Region: 38-337,403-439
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2e-90
Family Type II chitinase 0.0000000512
Further Details:      
 
Domain Number 2 Region: 339-405
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000141
Family Chitinase insertion domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134102990|ref|YP_001108651.1|
Sequence length 449
Comment chitinase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MALAAPPTFAATPAAAPSPATAQAPTAAQAPTAAEVPEARAANRRVGYFTQWSIYDRNYF
VKNLDTSGSAAKLTHVNYAFGNLDASGKCFQVNQAGEGDAWADYQRRFTADQTVSGQADT
YDQPLAGNLNQLKQLKAKYPHLKVHISFGGWTWSKNFHTAAATPESRAAHVKSCVDMWIR
GNLPKLGGEPQGGAGAAAGIFDGVDLDWEWPGSEGGPGNVVDPADKANFTALLQEWRKQL
DAVGQELGKSYEISAFLPADPKKIDAGFEVPKVFGLLDFGTIQGYDLHGAYEPTTNHQSA
IHSPAGDPHPEKWSIDQTVNAWLDRGAPADEMVLGVPFYGRGWTGVPNQNNGLFQSSTGP
APGRYEGGFEDYELLKARAGSFQLHRDGQAGFAWLFDGTTFWTYDDPTEIKRKMAYVKQK
ALGGAMVWSMDGDTPQGELMAAIDQGLGG
Download sequence
Identical sequences A4FNV1
WP_011875080.1.17192 WP_011875080.1.58781 WP_011875080.1.76288 gi|134102990|ref|YP_001108651.1| 405948.SACE_6558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]