SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134103453|ref|YP_001109114.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134103453|ref|YP_001109114.1|
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily Prim-pol domain 8.5e-22
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134103453|ref|YP_001109114.1|
Sequence length 337
Comment hypothetical protein SACE_7028 [Saccharopolyspora erythraea NRRL 2338]
Sequence
MTDPIRLAHWLIEHGMYVFPLRPYSKRPFGNCRRCKDNRCTQPCPCLTADRPCHGYLAAT
NQHRRARRWFTRMPAANVGISTDLSDTVVLDLDRKPKAPAAAAHDVPILVADGLGALDAI
TTHEGADWPDTLTIATPSEGRHLYFRRPAGLEVASDANGRVGHQIDIRAQGGYVVAPGCQ
ITAPPEDVFGTYTRVSTTVDIAPLPDWLRPRVTPPPATPTGPGKAPNLGRIRHGDGHEPG
YWKTVWKSVLDKVEYEDGERWKLVYNAARRLANLAVHDGAPWTEHEVLDELEAAAIRRRE
HTGKPTEPATARRNAQRGWDRGTHDGPDSLIGLGGAA
Download sequence
Identical sequences A4FQ64
405948.SACE_7028 gi|134103453|ref|YP_001109114.1| WP_009946137.1.17192 WP_009946137.1.58781 WP_009946137.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]