SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121634463|ref|YP_974708.1| from Neisseria meningitidis FAM18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121634463|ref|YP_974708.1|
Domain Number 1 Region: 279-411
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 2.75e-24
Family Cell-division protein ZipA, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121634463|ref|YP_974708.1|
Sequence length 428
Comment hypothetical protein NMC0615 [Neisseria meningitidis FAM18]
Sequence
MIYIVLFLAVVLAVVAYNMYQENQYRKKVRDQFGHSDKDALLNSKTSHVRDGKPSGGSVM
MPKPQPAVKKTAKPQDPAMRNLQEQDAVYIAKQKQAKASPFKTEIETALEESGIIGNSAH
TVSEPQTGHSAPKPADAPAKPAPVPQTPAKPLITLKELSKVELPWFDVRFDFISYIALTE
AKELHALPRLSNRCRYQIVGCTMDDHFQIAEPIPGIRYQAFIVGIQAVSRNGLASQEELS
AFNRQVDAFAQSMGGQTLHTDLAAFIEVASALDAFCARVDQTIAIHLVSPTSISGVELRS
AVTGVGFVLEDDGAFHYTDTSGSTMFSICSLNNEPFTNALLDNQSYKGFSMLLDIPHSPA
GEKTFDDLFMDLAVRLSGQLNLNLVNDKMEEVSTQWLKDVRTYVLARQSEMLKVGIEPGG
KTALRLFS
Download sequence
Identical sequences A0A0A8F4B6 A0A112FAC4 A1KSS8 Q9K0E2
gi|15676565|ref|NP_273709.1| 122586.NMB0667 272831.NMC0615 NP_273709.1.22327 WP_002247799.1.100741 WP_002247799.1.100975 WP_002247799.1.101472 WP_002247799.1.101655 WP_002247799.1.102138 WP_002247799.1.10289 WP_002247799.1.103 WP_002247799.1.11276 WP_002247799.1.11670 WP_002247799.1.12163 WP_002247799.1.13098 WP_002247799.1.13907 WP_002247799.1.15154 WP_002247799.1.15570 WP_002247799.1.1577 WP_002247799.1.1598 WP_002247799.1.15982 WP_002247799.1.16257 WP_002247799.1.16393 WP_002247799.1.17523 WP_002247799.1.17598 WP_002247799.1.18517 WP_002247799.1.19059 WP_002247799.1.1945 WP_002247799.1.19909 WP_002247799.1.21050 WP_002247799.1.21158 WP_002247799.1.21582 WP_002247799.1.22461 WP_002247799.1.22466 WP_002247799.1.24298 WP_002247799.1.24622 WP_002247799.1.24888 WP_002247799.1.25003 WP_002247799.1.25235 WP_002247799.1.2560 WP_002247799.1.25822 WP_002247799.1.25913 WP_002247799.1.2595 WP_002247799.1.26152 WP_002247799.1.26917 WP_002247799.1.27436 WP_002247799.1.28626 WP_002247799.1.2875 WP_002247799.1.29182 WP_002247799.1.29189 WP_002247799.1.29595 WP_002247799.1.30714 WP_002247799.1.31811 WP_002247799.1.31947 WP_002247799.1.32665 WP_002247799.1.32975 WP_002247799.1.33744 WP_002247799.1.34038 WP_002247799.1.34290 WP_002247799.1.34477 WP_002247799.1.34765 WP_002247799.1.35315 WP_002247799.1.35813 WP_002247799.1.35931 WP_002247799.1.36245 WP_002247799.1.36415 WP_002247799.1.36606 WP_002247799.1.37727 WP_002247799.1.3779 WP_002247799.1.38134 WP_002247799.1.38239 WP_002247799.1.38726 WP_002247799.1.38801 WP_002247799.1.38907 WP_002247799.1.39340 WP_002247799.1.40940 WP_002247799.1.41013 WP_002247799.1.41145 WP_002247799.1.425 WP_002247799.1.42656 WP_002247799.1.4349 WP_002247799.1.4417 WP_002247799.1.45333 WP_002247799.1.45642 WP_002247799.1.46627 WP_002247799.1.4705 WP_002247799.1.47204 WP_002247799.1.47277 WP_002247799.1.47808 WP_002247799.1.4784 WP_002247799.1.49775 WP_002247799.1.50295 WP_002247799.1.50983 WP_002247799.1.51446 WP_002247799.1.52092 WP_002247799.1.52785 WP_002247799.1.53014 WP_002247799.1.53544 WP_002247799.1.54018 WP_002247799.1.54436 WP_002247799.1.54666 WP_002247799.1.554 WP_002247799.1.55764 WP_002247799.1.56186 WP_002247799.1.56544 WP_002247799.1.56763 WP_002247799.1.57008 WP_002247799.1.5706 WP_002247799.1.57289 WP_002247799.1.57626 WP_002247799.1.58178 WP_002247799.1.58882 WP_002247799.1.59760 WP_002247799.1.59875 WP_002247799.1.59917 WP_002247799.1.60604 WP_002247799.1.6113 WP_002247799.1.6256 WP_002247799.1.62726 WP_002247799.1.63110 WP_002247799.1.63620 WP_002247799.1.63637 WP_002247799.1.64152 WP_002247799.1.64741 WP_002247799.1.65547 WP_002247799.1.65724 WP_002247799.1.65919 WP_002247799.1.65942 WP_002247799.1.66034 WP_002247799.1.66373 WP_002247799.1.66444 WP_002247799.1.66488 WP_002247799.1.67190 WP_002247799.1.67289 WP_002247799.1.6741 WP_002247799.1.67687 WP_002247799.1.68291 WP_002247799.1.68789 WP_002247799.1.69325 WP_002247799.1.70252 WP_002247799.1.70380 WP_002247799.1.70953 WP_002247799.1.7117 WP_002247799.1.71485 WP_002247799.1.72311 WP_002247799.1.72637 WP_002247799.1.72868 WP_002247799.1.73111 WP_002247799.1.73189 WP_002247799.1.75106 WP_002247799.1.75299 WP_002247799.1.75452 WP_002247799.1.76219 WP_002247799.1.7676 WP_002247799.1.77679 WP_002247799.1.78303 WP_002247799.1.78448 WP_002247799.1.7942 WP_002247799.1.79729 WP_002247799.1.79912 WP_002247799.1.80076 WP_002247799.1.80348 WP_002247799.1.81937 WP_002247799.1.83633 WP_002247799.1.83707 WP_002247799.1.84604 WP_002247799.1.84834 WP_002247799.1.84962 WP_002247799.1.853 WP_002247799.1.85974 WP_002247799.1.86394 WP_002247799.1.87082 WP_002247799.1.87230 WP_002247799.1.87513 WP_002247799.1.88349 WP_002247799.1.88546 WP_002247799.1.88755 WP_002247799.1.89456 WP_002247799.1.89576 WP_002247799.1.89811 WP_002247799.1.90067 WP_002247799.1.90460 WP_002247799.1.9112 WP_002247799.1.91395 WP_002247799.1.91783 WP_002247799.1.91834 WP_002247799.1.9273 WP_002247799.1.92753 WP_002247799.1.93003 WP_002247799.1.93756 WP_002247799.1.94047 WP_002247799.1.95052 WP_002247799.1.95799 WP_002247799.1.96262 WP_002247799.1.96310 WP_002247799.1.97217 WP_002247799.1.9780 WP_002247799.1.97906 WP_002247799.1.98884 WP_002247799.1.98951 WP_002247799.1.99100 WP_002247799.1.99597 gi|121634463|ref|YP_974708.1| gi|385853643|ref|YP_005900157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]