SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121634889|ref|YP_975134.1| from Neisseria meningitidis FAM18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121634889|ref|YP_975134.1|
Domain Number 1 Region: 152-352
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000846
Further Details:      
 
Domain Number 2 Region: 436-568
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000927
Further Details:      
 
Domain Number 3 Region: 16-147
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00028
Further Details:      
 
Domain Number 4 Region: 354-430
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.42e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121634889|ref|YP_975134.1|
Sequence length 589
Comment sulfite reductase subunit beta [Neisseria meningitidis FAM18]
Sequence
MTVQTKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDNFQLIRFHGMY
EQDDRDIRAERAEAKLEPLKFMLLRCRLPGGIIKPSQWIELDKFARENSHYRSIRLTNRQ
TFQFHGVPKAKLQTMHRLLHKLGLDSIATAADMNRNVLCTSNPIESELHRQAYEYAKKIS
EHLLPRTRGYLDVWVDGKKVQSSDDFLQEDEPILGKTYLPRKFKTAVVIPPLNDVDCYGN
DLDFVAVSDGNGQLAGFNVLAGGGLSMEHGNTKTYPNISLELGFVPPEHALKAAEAVVTT
QRDFGNRSDRKNARTRYTIQNMGLDNFRAEVERRMGMPFEPIRPFKFTGRGDRIGWVKGI
DGNWHLTLFIESGRLVDEGGKQLLTGVLEIAKIHKGDFRITANQNLIVANVAEADKAKIE
ELARTYGLIRNDVSKLRENAMSCVSFPTCPLAMAEAERVLPDFIGELDKIMAKHGTSDDY
IVTRITGCPNGCGRAMLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILSEL
DDLIGKWAAGRDTDEGFGDFAIRTGIVKPVLDAPVDFWDASKAVPIARA
Download sequence
Identical sequences A0A0Y6NPH7 A1KU05
gi|385855243|ref|YP_005901756.1| WP_002224541.1.101031 WP_002224541.1.101472 WP_002224541.1.101655 WP_002224541.1.102138 WP_002224541.1.10661 WP_002224541.1.10682 WP_002224541.1.11276 WP_002224541.1.11384 WP_002224541.1.11670 WP_002224541.1.12163 WP_002224541.1.13098 WP_002224541.1.13907 WP_002224541.1.15475 WP_002224541.1.16257 WP_002224541.1.16393 WP_002224541.1.17523 WP_002224541.1.17756 WP_002224541.1.18517 WP_002224541.1.19059 WP_002224541.1.19822 WP_002224541.1.19909 WP_002224541.1.21050 WP_002224541.1.22254 WP_002224541.1.22274 WP_002224541.1.24298 WP_002224541.1.24622 WP_002224541.1.25003 WP_002224541.1.25822 WP_002224541.1.2595 WP_002224541.1.26152 WP_002224541.1.27436 WP_002224541.1.27485 WP_002224541.1.28626 WP_002224541.1.2875 WP_002224541.1.29182 WP_002224541.1.29189 WP_002224541.1.29595 WP_002224541.1.31811 WP_002224541.1.31850 WP_002224541.1.32665 WP_002224541.1.32975 WP_002224541.1.33363 WP_002224541.1.33744 WP_002224541.1.34765 WP_002224541.1.35055 WP_002224541.1.35315 WP_002224541.1.35813 WP_002224541.1.35931 WP_002224541.1.36245 WP_002224541.1.36415 WP_002224541.1.36606 WP_002224541.1.37727 WP_002224541.1.38054 WP_002224541.1.38239 WP_002224541.1.38295 WP_002224541.1.38801 WP_002224541.1.39248 WP_002224541.1.40847 WP_002224541.1.40940 WP_002224541.1.40989 WP_002224541.1.41013 WP_002224541.1.42093 WP_002224541.1.425 WP_002224541.1.42656 WP_002224541.1.43987 WP_002224541.1.44409 WP_002224541.1.44572 WP_002224541.1.44580 WP_002224541.1.45642 WP_002224541.1.45671 WP_002224541.1.466 WP_002224541.1.46627 WP_002224541.1.4705 WP_002224541.1.47277 WP_002224541.1.47808 WP_002224541.1.4784 WP_002224541.1.48085 WP_002224541.1.48453 WP_002224541.1.49775 WP_002224541.1.51446 WP_002224541.1.52785 WP_002224541.1.53014 WP_002224541.1.53544 WP_002224541.1.54018 WP_002224541.1.54436 WP_002224541.1.54666 WP_002224541.1.5498 WP_002224541.1.55031 WP_002224541.1.554 WP_002224541.1.55764 WP_002224541.1.56186 WP_002224541.1.56544 WP_002224541.1.56763 WP_002224541.1.57008 WP_002224541.1.5706 WP_002224541.1.57238 WP_002224541.1.57289 WP_002224541.1.57387 WP_002224541.1.57626 WP_002224541.1.58178 WP_002224541.1.58501 WP_002224541.1.58882 WP_002224541.1.59760 WP_002224541.1.59875 WP_002224541.1.60604 WP_002224541.1.6113 WP_002224541.1.6141 WP_002224541.1.62726 WP_002224541.1.64152 WP_002224541.1.64741 WP_002224541.1.65724 WP_002224541.1.65919 WP_002224541.1.65942 WP_002224541.1.66034 WP_002224541.1.66444 WP_002224541.1.67190 WP_002224541.1.67289 WP_002224541.1.6741 WP_002224541.1.67687 WP_002224541.1.68789 WP_002224541.1.70252 WP_002224541.1.70953 WP_002224541.1.7117 WP_002224541.1.71485 WP_002224541.1.71789 WP_002224541.1.72311 WP_002224541.1.72637 WP_002224541.1.72868 WP_002224541.1.73111 WP_002224541.1.73189 WP_002224541.1.73922 WP_002224541.1.7399 WP_002224541.1.74771 WP_002224541.1.75106 WP_002224541.1.75299 WP_002224541.1.75688 WP_002224541.1.75849 WP_002224541.1.76330 WP_002224541.1.7676 WP_002224541.1.76807 WP_002224541.1.77030 WP_002224541.1.77679 WP_002224541.1.78231 WP_002224541.1.78905 WP_002224541.1.7942 WP_002224541.1.79489 WP_002224541.1.79912 WP_002224541.1.80076 WP_002224541.1.81005 WP_002224541.1.83633 WP_002224541.1.83707 WP_002224541.1.83954 WP_002224541.1.84565 WP_002224541.1.84604 WP_002224541.1.84834 WP_002224541.1.8494 WP_002224541.1.84962 WP_002224541.1.85974 WP_002224541.1.86132 WP_002224541.1.86394 WP_002224541.1.86562 WP_002224541.1.87082 WP_002224541.1.87513 WP_002224541.1.88349 WP_002224541.1.88546 WP_002224541.1.88755 WP_002224541.1.89456 WP_002224541.1.90460 WP_002224541.1.90543 WP_002224541.1.91073 WP_002224541.1.91395 WP_002224541.1.93756 WP_002224541.1.94047 WP_002224541.1.94259 WP_002224541.1.9571 WP_002224541.1.95799 WP_002224541.1.96262 WP_002224541.1.97018 WP_002224541.1.98884 WP_002224541.1.98951 WP_002224541.1.98994 WP_002224541.1.9906 WP_002224541.1.99100 WP_002224541.1.99570 WP_002224541.1.99597 272831.NMC1091 gi|121634889|ref|YP_975134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]