SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121635334|ref|YP_975579.1| from Neisseria meningitidis FAM18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121635334|ref|YP_975579.1|
Domain Number 1 Region: 5-329
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.8e-124
Family UbiD middle domain-like 0.000000000385
Further Details:      
 
Domain Number 2 Region: 330-494
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 2.22e-66
Family UbiD C-terminal domain-like 0.0000000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121635334|ref|YP_975579.1|
Sequence length 494
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Neisseria meningitidis FAM18]
Sequence
MNMKYKDLRDFIAMLEQQGKLKRIAHPVSPHLEMTEIADRVLRAEGPALLFENPVKPDGT
RYGYPVLANLFGTPERVAMGMGADSVSKLREIGQTLAYLKEPEPPKGIKDAFSKLPLLKD
IWSMAPNVVKNAPCQEIVWEGENVDLYKLPIQHCWPEDVAPLVTWGLTVTRGPHKKRQNL
GIYRQQLIGKNKLIMRWLSHRGGALDYQEFRKLNPDTPYPVAVVLGCDPATILGAVTPVP
DTLSEYQFAGLLRGSRTELVKCIGNDLQVPARAEIVLEGVIHPNETALEGPYGDHTGYYN
EQDHFPVFTVERITMRENPIYHSTYTGKPPDEPAVLGVALNEVFVPLLQKQFPEITDFYL
PPEGCSYRMAVVSMKKQYAGHAKRVMMGCWSFLRQFMYTKFIIVVDDDVNVRDWKEVIWA
VTTRMDPVRDTVLVENTPIDYLDFASPVSGLGGKMGLDATNKWPGETDREWGRVIKKDPA
VTAKIDGIWEELGL
Download sequence
Identical sequences 272831.NMC1611 gi|121635334|ref|YP_975579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]