SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253690338|ref|YP_003019528.1| from Pectobacterium carotovorum subsp. carotovorum PC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253690338|ref|YP_003019528.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.84e-39
Family Frataxin-like 0.00000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253690338|ref|YP_003019528.1|
Sequence length 106
Comment iron donor protein CyaY [Pectobacterium carotovorum subsp. carotovorum PC1]
Sequence
MNDSEFHQLADELMLQLEETLDRFEGDADIDYETNGGVMTLSFENGSKIVINRQEPLHQI
WLATKAGGYHFNRQETRWICDRSGEDFITLLSSACSTQAGETVRFE
Download sequence
Identical sequences C6DHB9
WP_015842072.1.10570 561230.PC1_3977 gi|253690338|ref|YP_003019528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]